(data stored in ACNUC30630 zone)

EMBL: CP001515.PE86

CP001515.PE86        Location/Qualifiers
FT   CDS             complement(100270..101808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0088"
FT                   /product="phosphoprotein phosphatase"
FT                   /note="COG0631 Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45484"
FT                   /protein_id="ACS45484.1"
FT                   /translation="MYSTTVSDVGTVRSNNQDSSFAGEHLVAVCDGMGGHAGGDTASTI
FT                   AIRSLAHIETDSAGGDVAKAAAIIEASTLAAHDAIVGKAKRERKLAGMGTTVTAITLVS
FT                   DYWVIAHIGDSRAYLLRDGKLMRLTTDHSYVQHLIDTKRINEVEARNHPQRNVVMRVLG
FT                   DFDIDAHPDISIRRAEAGDRLLLCSDGLCGVLEDSTIEETLSHFTDPEECAQTLVSMAL
FT                   KAGSTDNVSAVIADSTIALDADSFDLPHQTPLIGGAASATLEPIADIIHEPVASAPALI
FT                   TRSSPAERAAALIASDSNKAAQSEEHDATQQVAQPSTVREENGELQDPDTGEIPVIRKS
FT                   DGRYSADPNDPEVARAIHHEHLQEKKQARSRRFRGKIIGSVVAVAIVAVLALGTWAAYA
FT                   WSQTQYYLASDNGVVTVYQGVPTNIFGYELSHAIEHTDLKVDELPEQWQDRLRQGISVD
FT                   GYDEALSHVELIRTQFNDLKKEQEQKAKEDADAKAKQQKQANDSKSPTKSAQSR"
     MYSTTVSDVG TVRSNNQDSS FAGEHLVAVC DGMGGHAGGD TASTIAIRSL AHIETDSAGG        60
     DVAKAAAIIE ASTLAAHDAI VGKAKRERKL AGMGTTVTAI TLVSDYWVIA HIGDSRAYLL       120
     RDGKLMRLTT DHSYVQHLID TKRINEVEAR NHPQRNVVMR VLGDFDIDAH PDISIRRAEA       180
     GDRLLLCSDG LCGVLEDSTI EETLSHFTDP EECAQTLVSM ALKAGSTDNV SAVIADSTIA       240
     LDADSFDLPH QTPLIGGAAS ATLEPIADII HEPVASAPAL ITRSSPAERA AALIASDSNK       300
     AAQSEEHDAT QQVAQPSTVR EENGELQDPD TGEIPVIRKS DGRYSADPND PEVARAIHHE       360
     HLQEKKQARS RRFRGKIIGS VVAVAIVAVL ALGTWAAYAW SQTQYYLASD NGVVTVYQGV       420
     PTNIFGYELS HAIEHTDLKV DELPEQWQDR LRQGISVDGY DEALSHVELI RTQFNDLKKE       480
     QEQKAKEDAD AKAKQQKQAN DSKSPTKSAQ SR                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page