(data stored in ACNUC30630 zone)

EMBL: CP001515.PE88

CP001515.PE88        Location/Qualifiers
FT   CDS             complement(102394..103095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0090"
FT                   /product="hypothetical protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45486"
FT                   /protein_id="ACS45486.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIESWGSEAMANELADNLTQYAKSQHYAFVGPVVVI
FT                   FEEDLQLTKGNFKLTSESVQGNAVPVTTDEQAEDCPMLEVNNNQYLLTKDKTILGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASSQDQR"
     MSVLDRFEKS VEGAVNGVFA KFGSKDLQPV DLSSALEREI DAEAMPVGRD RTVAPNEYRF        60
     KLSTPDFDRI ESWGSEAMAN ELADNLTQYA KSQHYAFVGP VVVIFEEDLQ LTKGNFKLTS       120
     ESVQGNAVPV TTDEQAEDCP MLEVNNNQYL LTKDKTILGR GSGCDIVIDD PGISRKHLEI       180
     DITDNGVIAR DLGSTNGTYV EGHQVPAATL LDGNTITIGR TRILYWASSQ DQR              233
//

If you have problems or comments...

PBIL Back to PBIL home page