(data stored in ACNUC30630 zone)

EMBL: CP001515.PE95

CP001515.PE95        Location/Qualifiers
FT   CDS             complement(111113..111370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0097"
FT                   /product="integral membrane protein"
FT                   /note="COG2261 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45493"
FT                   /protein_id="ACS45493.1"
FT                   /translation="MDTMFWIWTLIVGAVIGAIAGAITNNGHSMGWISNILAGLAGSAL
FT                   GQGLFGSWGPSLGGMAVVPSVLGAVIVVAIVSFIVMKVRA"
     MDTMFWIWTL IVGAVIGAIA GAITNNGHSM GWISNILAGL AGSALGQGLF GSWGPSLGGM        60
     AVVPSVLGAV IVVAIVSFIV MKVRA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page