(data stored in ACNUC30630 zone)

EMBL: CP001515.RPMF

CP001515.RPMF        Location/Qualifiers
FT   CDS             complement(346664..346858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="Balac_0278"
FT                   /product="50S ribosomal protein L32"
FT                   /note="COG0333 Ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45669"
FT                   /protein_id="ACS45669.1"
FT                   /translation="MALPKYKMSRANTRTRRSTWKAKAAQTITCPNCGAPTLAHVACPS
FT                   CGSYRGRVYREAIRSAHTK"
     MALPKYKMSR ANTRTRRSTW KAKAAQTITC PNCGAPTLAH VACPSCGSYR GRVYREAIRS        60
     AHTK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page