(data stored in ACNUC30630 zone)

EMBL: CP001515.RPSB

CP001515.RPSB        Location/Qualifiers
FT   CDS             904919..905830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="Balac_0773"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46141"
FT                   /protein_id="ACS46141.1"
FT                   /translation="MAQITMSEMLKAGLQFGHQTRRWNPKMKQYILTERNGIYIINLFK
FT                   TLDLIDVAYDFIKTTVAHNGTVLFVGTKKQAQEAIKNAATRVNMPYVSERWLGGMLTNF
FT                   QTVSKRVNRLKELETMDFDDVHGSGLTKKELLLLKREKDKLERQLGGIRNMTRTPSAMF
FT                   VVDINKEALAVEEAHKLGIPVVAIVDTNADPEAVEYPIPANDDAIRGIELLTNLFADAV
FT                   AEGLLERSGNASKSESNSEQPMAAWEKELLEKNEKATLRENAVVTENEVKKTDEEEGAS
FT                   SEAARADAQNEEAVAKPGEEVE"
     MAQITMSEML KAGLQFGHQT RRWNPKMKQY ILTERNGIYI INLFKTLDLI DVAYDFIKTT        60
     VAHNGTVLFV GTKKQAQEAI KNAATRVNMP YVSERWLGGM LTNFQTVSKR VNRLKELETM       120
     DFDDVHGSGL TKKELLLLKR EKDKLERQLG GIRNMTRTPS AMFVVDINKE ALAVEEAHKL       180
     GIPVVAIVDT NADPEAVEYP IPANDDAIRG IELLTNLFAD AVAEGLLERS GNASKSESNS       240
     EQPMAAWEKE LLEKNEKATL RENAVVTENE VKKTDEEEGA SSEAARADAQ NEEAVAKPGE       300
     EVE                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page