(data stored in ACNUC30630 zone)

EMBL: CP001515.RPSL

CP001515.RPSL        Location/Qualifiers
FT   CDS             727059..727367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="Balac_0617"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45990"
FT                   /protein_id="ACS45990.1"
FT                   /translation="MALKGSPLRRGVCTRVYTTTPKKPNSALRKVARVRLSSGIEVTAY
FT                   IPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTQGVKDRKQGRSLYGAKKAK"
     MALKGSPLRR GVCTRVYTTT PKKPNSALRK VARVRLSSGI EVTAYIPGEG HNLQEHSIVL        60
     VRGGRVKDLP GVRYHIVRGA LDTQGVKDRK QGRSLYGAKK AK                          102
//

If you have problems or comments...

PBIL Back to PBIL home page