(data stored in ACNUC30630 zone)

EMBL: CP001515.RPSN

CP001515.RPSN        Location/Qualifiers
FT   CDS             475498..475683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="Balac_0395"
FT                   /product="30S ribosomal protein S14"
FT                   /note="COG0199 Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45778"
FT                   /protein_id="ACS45778.1"
FT                   /translation="MAKTCLKVKALRKPKFKVRAYTRCMVCGRPHSVYRKFGLCRICLR
FT                   EKAHRGELPGVTKSSW"
     MAKTCLKVKA LRKPKFKVRA YTRCMVCGRP HSVYRKFGLC RICLREKAHR GELPGVTKSS        60
     W                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page