(data stored in ACNUC7421 zone)

EMBL: CP001600.PE10

CP001600.PE10        Location/Qualifiers
FT   CDS             9631..10098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0010"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67272"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD4"
FT                   /protein_id="ACR67272.1"
FT                   /translation="MRNYDLAPLMRQWIGFDKLANAMQTSLEPQGFPPYNIEKSDDNHY
FT                   RISLALAGFRQSELDLEVEGPRLTVRGNPVKPEKPVEYLHQGLVCKAFELSFTLAEHLT
FT                   VEGAAFENGLLNIDLVRHVPEALQPQRIVISAAPRDPAALECRNEPDTHQQ"
     MRNYDLAPLM RQWIGFDKLA NAMQTSLEPQ GFPPYNIEKS DDNHYRISLA LAGFRQSELD        60
     LEVEGPRLTV RGNPVKPEKP VEYLHQGLVC KAFELSFTLA EHLTVEGAAF ENGLLNIDLV       120
     RHVPEALQPQ RIVISAAPRD PAALECRNEP DTHQQ                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page