(data stored in ACNUC7421 zone)

EMBL: CP001600.PE100

CP001600.PE100       Location/Qualifiers
FT   CDS             complement(102727..103875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0108"
FT                   /product="Protein of unknown function (DUF513), HemX"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67363"
FT                   /db_xref="GOA:C5BBC8"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC8"
FT                   /protein_id="ACR67363.1"
FT                   /translation="MTEPTTPPDKAAAAETATKQAQPLERAHKQDKQLVKKSAASGPAL
FT                   GAIAIVLVIALGAGLYYHGHQQAQMQQATEQSLQEQLSALHTAQAQEKLRMEALLNKQA
FT                   KALDVATQLQASQSQQLKELEQKVAAISGNDANTWKLAQADFMVKLAERKLWSDQDVTT
FT                   AIALLKSADATLAGLGDPSLLGVRRALTEDIATLSALNQIDFDGIILQLNQLANQVDDL
FT                   RLADNDSDEAPMDQDDGELSASLSQWRQNLAKSWHSFISEFITIRRRDSSAEPLLAPSQ
FT                   DVYLRENIRSRLLIAAQAIPRHQNQIYQQSLESVSAWVRAYFDVNDPSTKAFLNQIDAL
FT                   SQQSVSMILPDALKSQPLLDKLLHARSHALTAAPTAPATQGE"
     MTEPTTPPDK AAAAETATKQ AQPLERAHKQ DKQLVKKSAA SGPALGAIAI VLVIALGAGL        60
     YYHGHQQAQM QQATEQSLQE QLSALHTAQA QEKLRMEALL NKQAKALDVA TQLQASQSQQ       120
     LKELEQKVAA ISGNDANTWK LAQADFMVKL AERKLWSDQD VTTAIALLKS ADATLAGLGD       180
     PSLLGVRRAL TEDIATLSAL NQIDFDGIIL QLNQLANQVD DLRLADNDSD EAPMDQDDGE       240
     LSASLSQWRQ NLAKSWHSFI SEFITIRRRD SSAEPLLAPS QDVYLRENIR SRLLIAAQAI       300
     PRHQNQIYQQ SLESVSAWVR AYFDVNDPST KAFLNQIDAL SQQSVSMILP DALKSQPLLD       360
     KLLHARSHAL TAAPTAPATQ GE                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page