(data stored in ACNUC7421 zone)

EMBL: CP001600.PE104

CP001600.PE104       Location/Qualifiers
FT   CDS             complement(108465..108788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0112"
FT                   /product="iron donor protein CyaY, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67367"
FT                   /db_xref="GOA:C5BBD2"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BBD2"
FT                   /protein_id="ACR67367.1"
FT                   /translation="MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFEN
FT                   GSKIVINRQEPLHQIWLATRAGGYHFDYRNGQWRCSRSGVPLPQVLNEACSAQAGIPVT
FT                   LDL"
     MNDSEFHLLA DGLMQALEEA LDACQSDADI DCETNGGVMT LSFENGSKIV INRQEPLHQI        60
     WLATRAGGYH FDYRNGQWRC SRSGVPLPQV LNEACSAQAG IPVTLDL                     107
//

If you have problems or comments...

PBIL Back to PBIL home page