(data stored in ACNUC7421 zone)

EMBL: CP001600.PE107

CP001600.PE107       Location/Qualifiers
FT   CDS             109989..110693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0115"
FT                   /product="Protein of unknown function, DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67370"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD5"
FT                   /protein_id="ACR67370.1"
FT                   /translation="MSERDSRDRLQPSLADDQVVAYLQQHPDFFIRNARLVEQMMIPHP
FT                   VRGAVSLLEWQLGRQRRQIAVLDQEIEQLITLARDNERLFGSLLALQGHLASAQDVDDF
FT                   LQRLQRWARSLGLSGAYIRLFSDRWRLGAPSRFSHLAIARSDVELLRIQRLGDASHYLG
FT                   SLNGQELLLLLPQARHVGSVALSLMGDFADLGLLVFTSADVQHYQQGMGTALLEQLARL
FT                   IPPMLTRWIERQ"
     MSERDSRDRL QPSLADDQVV AYLQQHPDFF IRNARLVEQM MIPHPVRGAV SLLEWQLGRQ        60
     RRQIAVLDQE IEQLITLARD NERLFGSLLA LQGHLASAQD VDDFLQRLQR WARSLGLSGA       120
     YIRLFSDRWR LGAPSRFSHL AIARSDVELL RIQRLGDASH YLGSLNGQEL LLLLPQARHV       180
     GSVALSLMGD FADLGLLVFT SADVQHYQQG MGTALLEQLA RLIPPMLTRW IERQ             234
//

If you have problems or comments...

PBIL Back to PBIL home page