(data stored in ACNUC7421 zone)

EMBL: CP001600.PE113

CP001600.PE113       Location/Qualifiers
FT   CDS             118081..118995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0121"
FT                   /product="phospholipase protein family"
FT                   /EC_number="3.1.1.32"
FT                   /EC_number="3.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67376"
FT                   /db_xref="GOA:C5BBE1"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBE1"
FT                   /protein_id="ACR67376.1"
FT                   /translation="MSDVVMKELKKQRISGRTWMAAGLVLLPLTAQADGESGATQALQH
FT                   NEGVIANMLRHYDNPFTLYPYATNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISL
FT                   AFPIWRGIAGDNSVLGAAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGW
FT                   VLRDIEAGGVHQSNGRADPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPSKDDNPD
FT                   ITKYMGYYEAEMGYRLGESVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYG
FT                   ESLIDYNFRQTRFGVGVMLNDIL"
     MSDVVMKELK KQRISGRTWM AAGLVLLPLT AQADGESGAT QALQHNEGVI ANMLRHYDNP        60
     FTLYPYATNY VLYTQTSDIN KEAISSYDWG DQAKKNEIKF QISLAFPIWR GIAGDNSVLG       120
     AAYTQQSWWQ AFNRSESSPF RETNYEPRLF LGWATDYPLF GGWVLRDIEA GGVHQSNGRA       180
     DPTSRSWNRV YTRFLAQNGN FQVQLMPWYR IPESPSKDDN PDITKYMGYY EAEMGYRLGE       240
     SVFSLRGRYN WNSGYGAAEL GWSYPLTRHV RFYTQLFSGY GESLIDYNFR QTRFGVGVML       300
     NDIL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page