(data stored in ACNUC7421 zone)

EMBL: CP001600.PE117

CP001600.PE117       Location/Qualifiers
FT   CDS             complement(122599..123129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0125"
FT                   /product="carbohydrate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67380"
FT                   /db_xref="GOA:C5BC89"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC89"
FT                   /protein_id="ACR67380.1"
FT                   /translation="MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPR
FT                   ANISKMADGHALNDDDRTPWLQALNDAVFAMQRTNGVSLIVCSALKKRYRDMLRDGNTN
FT                   LSFIYLQGDFALIESRLLARKGHFFKPQMLVSQFAALEEPTTEERDVFAIDISQPLDNV
FT                   VADTLNTIKSIIA"
     MSESQQQKHV FVLMGVSGSG KSAVANAVAQ RLGAAFLDGD FLHPRANISK MADGHALNDD        60
     DRTPWLQALN DAVFAMQRTN GVSLIVCSAL KKRYRDMLRD GNTNLSFIYL QGDFALIESR       120
     LLARKGHFFK PQMLVSQFAA LEEPTTEERD VFAIDISQPL DNVVADTLNT IKSIIA           176
//

If you have problems or comments...

PBIL Back to PBIL home page