(data stored in ACNUC7421 zone)

EMBL: CP001600.PE12

CP001600.PE12        Location/Qualifiers
FT   CDS             complement(11620..12339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0013"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67274"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD6"
FT                   /protein_id="ACR67274.1"
FT                   /translation="MTFAVKTWVQRLLMPVMALFFVMQLSGCGDSDKEQQKAFIDYLQN
FT                   TVMRGSVTIPTLSEAQKQQLGHYAGDYALLVTFSQNFNHAMEGSMTPLFNTLQQIRTPQ
FT                   EYLTQRDRLQRELGALNMLGQQIQSAKALADSTYATLKQPEEVKAVFDKAFTKIVTGPS
FT                   NAVMPMIPQAEAVAKTLVQVGDFLQNLGPQVHFDNQGVQLQTQAQVDQYNQLMRDLSVK
FT                   YQALMAAQQQNAGLLQN"
     MTFAVKTWVQ RLLMPVMALF FVMQLSGCGD SDKEQQKAFI DYLQNTVMRG SVTIPTLSEA        60
     QKQQLGHYAG DYALLVTFSQ NFNHAMEGSM TPLFNTLQQI RTPQEYLTQR DRLQRELGAL       120
     NMLGQQIQSA KALADSTYAT LKQPEEVKAV FDKAFTKIVT GPSNAVMPMI PQAEAVAKTL       180
     VQVGDFLQNL GPQVHFDNQG VQLQTQAQVD QYNQLMRDLS VKYQALMAAQ QQNAGLLQN        239
//

If you have problems or comments...

PBIL Back to PBIL home page