(data stored in ACNUC7421 zone)

EMBL: CP001600.PE120

CP001600.PE120       Location/Qualifiers
FT   CDS             126933..128090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0128"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67383"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC92"
FT                   /protein_id="ACR67383.1"
FT                   /translation="MLHEVTLNYCYTPHPAFISTHFITLNNMNNRALLSCLSGVLMSGV
FT                   AHAATSGNTTELSSTLPSYYGLPQSQAHAVDSVSTAQTPVPEVQKESILPIWGNEARAR
FT                   GYDLPEPFGINVNYMNMRQNIVVDSIGFSGLGWDSYSLPTDLFNIKVGNTRQRSVTQTI
FT                   KLDAWVLPFMNVYSIVGKTRGSSLSKVSVDADPSHYTPGSMDWIIATVVQGMNKSGQLR
FT                   DLDFRLNFKGTTYGAGTVLAGGYGNWFGLVDMNYTQTRFDILDGSIDAFTLSPRVGYRF
FT                   TTPGIDAVGLPDGKLSLWVGSMYQDVQQEFKGTLSDLSMPGGLSALMEIANKQGQGRFD
FT                   VHQHLSSPWNVLIGAQYEITRNFNLTTEVGFAERNSFFISGEYRF"
     MLHEVTLNYC YTPHPAFIST HFITLNNMNN RALLSCLSGV LMSGVAHAAT SGNTTELSST        60
     LPSYYGLPQS QAHAVDSVST AQTPVPEVQK ESILPIWGNE ARARGYDLPE PFGINVNYMN       120
     MRQNIVVDSI GFSGLGWDSY SLPTDLFNIK VGNTRQRSVT QTIKLDAWVL PFMNVYSIVG       180
     KTRGSSLSKV SVDADPSHYT PGSMDWIIAT VVQGMNKSGQ LRDLDFRLNF KGTTYGAGTV       240
     LAGGYGNWFG LVDMNYTQTR FDILDGSIDA FTLSPRVGYR FTTPGIDAVG LPDGKLSLWV       300
     GSMYQDVQQE FKGTLSDLSM PGGLSALMEI ANKQGQGRFD VHQHLSSPWN VLIGAQYEIT       360
     RNFNLTTEVG FAERNSFFIS GEYRF                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page