(data stored in ACNUC7421 zone)

EMBL: CP001600.PE121

CP001600.PE121       Location/Qualifiers
FT   CDS             128090..129223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0129"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67384"
FT                   /db_xref="GOA:C5BC93"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC93"
FT                   /protein_id="ACR67384.1"
FT                   /translation="MRRHLMALALVCTLSPLEGQADLLPTRAQIDEWLGHLGGDDRFDP
FT                   DKGIDWGVLPGPFFNPELGLGVGTAVAGLYRPDPSDTVSQNSSITLSGYLSSTGAFGLG
FT                   VRSYSFFDNDRWRIFVTGGLSDTPTYYWGQGFRAGADDDGRQKYTAQSLRLQPDVLYRV
FT                   ASQTYLGVGWSLSAMHAADVKQTDRLAQIRDGRTVFSSGPSLSLQYDSRDFVPNPHRGM
FT                   LASLRYTHYTPEAGSDTRFDNLMTRFSTYHALDATRVLAWEIDGEFTQGAVPWNMLPSL
FT                   GGDQRMRGYYQGRYRDRNLISSQLEYRQKLSWRHGVVAWAGAGTMGPNVRELGSSRWLP
FT                   TVGVGYRFAFKPGINIRLDYGIGRGSSGFYFQVGEAF"
     MRRHLMALAL VCTLSPLEGQ ADLLPTRAQI DEWLGHLGGD DRFDPDKGID WGVLPGPFFN        60
     PELGLGVGTA VAGLYRPDPS DTVSQNSSIT LSGYLSSTGA FGLGVRSYSF FDNDRWRIFV       120
     TGGLSDTPTY YWGQGFRAGA DDDGRQKYTA QSLRLQPDVL YRVASQTYLG VGWSLSAMHA       180
     ADVKQTDRLA QIRDGRTVFS SGPSLSLQYD SRDFVPNPHR GMLASLRYTH YTPEAGSDTR       240
     FDNLMTRFST YHALDATRVL AWEIDGEFTQ GAVPWNMLPS LGGDQRMRGY YQGRYRDRNL       300
     ISSQLEYRQK LSWRHGVVAW AGAGTMGPNV RELGSSRWLP TVGVGYRFAF KPGINIRLDY       360
     GIGRGSSGFY FQVGEAF                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page