(data stored in ACNUC7421 zone)

EMBL: CP001600.PE122

CP001600.PE122       Location/Qualifiers
FT   CDS             129223..130356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0130"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67385"
FT                   /db_xref="InterPro:IPR025130"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC94"
FT                   /protein_id="ACR67385.1"
FT                   /translation="MTAVRGLCAVLLTWCGVAGAFGLPMSLDLAPLQLQQAAHVWPVSA
FT                   PLLPPDGLRPCCAFGYDLNAEALGIPIPFYRLNNVVEADALGAHRYNDSLFGALASLAG
FT                   LGSERNGLIYTRRGGFLDLAHVRDSADMTVYIFSHLYPRLGQAFRLELGDELARRQLVL
FT                   SAFTPPHEARERYTLAAYLAARLAFEVAAWHEIAQWYGYESIPGFSEGVSAFSPEDLYS
FT                   NLLGTRLALTLILNGYTASLGQYSAALTTLLPQALCQLQAQPAVLTRFQFDMLDGKWWD
FT                   SHQAVPQKFLVLKRNYDTHADRLPTPIPGELTPPLRLMLPGQVYHYDLARLAELRLLPG
FT                   ASMKRLPAPPRYYTWRDFSHLAAFARTQDALQLSRKR"
     MTAVRGLCAV LLTWCGVAGA FGLPMSLDLA PLQLQQAAHV WPVSAPLLPP DGLRPCCAFG        60
     YDLNAEALGI PIPFYRLNNV VEADALGAHR YNDSLFGALA SLAGLGSERN GLIYTRRGGF       120
     LDLAHVRDSA DMTVYIFSHL YPRLGQAFRL ELGDELARRQ LVLSAFTPPH EARERYTLAA       180
     YLAARLAFEV AAWHEIAQWY GYESIPGFSE GVSAFSPEDL YSNLLGTRLA LTLILNGYTA       240
     SLGQYSAALT TLLPQALCQL QAQPAVLTRF QFDMLDGKWW DSHQAVPQKF LVLKRNYDTH       300
     ADRLPTPIPG ELTPPLRLML PGQVYHYDLA RLAELRLLPG ASMKRLPAPP RYYTWRDFSH       360
     LAAFARTQDA LQLSRKR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page