(data stored in ACNUC7421 zone)

EMBL: CP001600.PE123

CP001600.PE123       Location/Qualifiers
FT   CDS             130476..131375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0131"
FT                   /product="Carboxylate/Amino Acid/Amine Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67386"
FT                   /db_xref="GOA:C5BC95"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC95"
FT                   /protein_id="ACR67386.1"
FT                   /translation="MFLLLATTLLWAFSFSLIGVYLAGQVDSWFAVLVRIALATLVFLP
FT                   FLRWRGVRPRQALAYMLVGAFQLGLMYLFYYPAFLYLTVPEVLLFTILTPLYVTLIYDL
FT                   LQGRRLRPGYLGSALLAVLGALIIRYNPLSSQFLLGFSLIQGANLCFALGQVGYKRLME
FT                   VMPLPQYRAFSWFYLGALTVALPAWWLYGNPQMLPTTSLQWGILLWLGVGASGLGYFMW
FT                   NYGATQVDAGTLAIMNNALIPAGLLVNLAIWQQHPDWFRLTLGGTVIALSLWVHRRWIV
FT                   PHPGRMAGHRRRGGAPAE"
     MFLLLATTLL WAFSFSLIGV YLAGQVDSWF AVLVRIALAT LVFLPFLRWR GVRPRQALAY        60
     MLVGAFQLGL MYLFYYPAFL YLTVPEVLLF TILTPLYVTL IYDLLQGRRL RPGYLGSALL       120
     AVLGALIIRY NPLSSQFLLG FSLIQGANLC FALGQVGYKR LMEVMPLPQY RAFSWFYLGA       180
     LTVALPAWWL YGNPQMLPTT SLQWGILLWL GVGASGLGYF MWNYGATQVD AGTLAIMNNA       240
     LIPAGLLVNL AIWQQHPDWF RLTLGGTVIA LSLWVHRRWI VPHPGRMAGH RRRGGAPAE        299
//

If you have problems or comments...

PBIL Back to PBIL home page