(data stored in ACNUC7421 zone)

EMBL: CP001600.PE127

CP001600.PE127       Location/Qualifiers
FT   CDS             137086..137613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0138"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67393"
FT                   /db_xref="GOA:C5BCA2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA2"
FT                   /protein_id="ACR67393.1"
FT                   /translation="MLDSLIQGTIEFVRLHQDWAVPLVFFLAFGESLAFISLLLPATVI
FT                   LFALSALLGEGGVPFVPVWLAAACGAFLGDWISYWLGYHYQHQIGHIWPLSRNPQILQR
FT                   GHRYFERWGFWGVFFGRFLGPLRAAVPLVAGICAMRQRYFQLANLLSALIWGAGILAPG
FT                   MLGIRWLGQWIG"
     MLDSLIQGTI EFVRLHQDWA VPLVFFLAFG ESLAFISLLL PATVILFALS ALLGEGGVPF        60
     VPVWLAAACG AFLGDWISYW LGYHYQHQIG HIWPLSRNPQ ILQRGHRYFE RWGFWGVFFG       120
     RFLGPLRAAV PLVAGICAMR QRYFQLANLL SALIWGAGIL APGMLGIRWL GQWIG            175
//

If you have problems or comments...

PBIL Back to PBIL home page