(data stored in ACNUC7421 zone)

EMBL: CP001600.PE128

CP001600.PE128       Location/Qualifiers
FT   CDS             137716..139125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0139"
FT                   /product="RmuC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67394"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA3"
FT                   /protein_id="ACR67394.1"
FT                   /translation="MENVTLWILAASLAGMVIGWLAAALRTQQARVAHEQALGALDSQL
FT                   AAAQERIAQQQLWHEECERLNQELRAQRDVNSAQEAELREVTIRLEETRMGAEEKQRLL
FT                   LNAEQRLNVQFENLANRIFEHSGRRVEEQNRQSLDALLMPLREQLDGFRRQINDSFGQE
FT                   ARERHTLTHEIRSLQQMNAQMAREALNLTRALKGDNKMQGNWGEVVLSRVLESSGLREG
FT                   HEYHSQVSVQTEESGRMQPDVVVHLPQGKDVVVDAKMSLVAYERFFNAEDEHERELALQ
FT                   QHILSLRAHIRQLGRKDYQQLPGLRTLDYVLMFIPLEPAFLAAIERDSELISEALRHNI
FT                   MLVSPTTLLVALRTINNLWRYEYQSQNAQKIADRAAKLYDKVRLFVDDMSTLGQSLERA
FT                   QSSYRQAMNKLSHGRGNLIGQVESFRGLGVEVKRPISPALVQEACQPLQDGDPAVVSGE
FT                   VVAHHGTPSVQ"
     MENVTLWILA ASLAGMVIGW LAAALRTQQA RVAHEQALGA LDSQLAAAQE RIAQQQLWHE        60
     ECERLNQELR AQRDVNSAQE AELREVTIRL EETRMGAEEK QRLLLNAEQR LNVQFENLAN       120
     RIFEHSGRRV EEQNRQSLDA LLMPLREQLD GFRRQINDSF GQEARERHTL THEIRSLQQM       180
     NAQMAREALN LTRALKGDNK MQGNWGEVVL SRVLESSGLR EGHEYHSQVS VQTEESGRMQ       240
     PDVVVHLPQG KDVVVDAKMS LVAYERFFNA EDEHERELAL QQHILSLRAH IRQLGRKDYQ       300
     QLPGLRTLDY VLMFIPLEPA FLAAIERDSE LISEALRHNI MLVSPTTLLV ALRTINNLWR       360
     YEYQSQNAQK IADRAAKLYD KVRLFVDDMS TLGQSLERAQ SSYRQAMNKL SHGRGNLIGQ       420
     VESFRGLGVE VKRPISPALV QEACQPLQDG DPAVVSGEVV AHHGTPSVQ                   469
//

If you have problems or comments...

PBIL Back to PBIL home page