(data stored in ACNUC7421 zone)

EMBL: CP001600.PE13

CP001600.PE13        Location/Qualifiers
FT   CDS             complement(12472..14541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0014"
FT                   /product="glycyl-tRNA synthetase, beta subunit, putative"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67275"
FT                   /db_xref="GOA:C5B995"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B995"
FT                   /protein_id="ACR67275.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDI
FT                   EWFAAPRRLALKVAALNAAQPDREIEKRGPAIAQAFDAEGKPTKAAEGWARGCGISVDQ
FT                   AERLSTDKGEWLLYRALQKGQRAQDLLPALVASALSRLPIPKLMRWGDSDTQFVRPVHT
FT                   VTLLLGSESIPATILGVPSDRVIRGHRFMGEAEFTLDSADQYPQILLERGKVIADYDAR
FT                   KALIKRDAEAAAARIGGVADLSDSLLEEVTSLVEWPVVLTARFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIDSKDAQQIIAGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLESVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDALPTSLVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVRLYGDKLGN
FT                   ASVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSHFRTLPEA
FT                   ATLAAANKRVSNILAKSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLAPLFADGRYQ
FT                   EALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADISVLQ"
     MTQQTFLVEI GTEELPPKAL RSLAQAFADN FRTELDNAGL AHGDIEWFAA PRRLALKVAA        60
     LNAAQPDREI EKRGPAIAQA FDAEGKPTKA AEGWARGCGI SVDQAERLST DKGEWLLYRA       120
     LQKGQRAQDL LPALVASALS RLPIPKLMRW GDSDTQFVRP VHTVTLLLGS ESIPATILGV       180
     PSDRVIRGHR FMGEAEFTLD SADQYPQILL ERGKVIADYD ARKALIKRDA EAAAARIGGV       240
     ADLSDSLLEE VTSLVEWPVV LTARFEEKFL AVPAEALVYT MKGDQKYFPV YDAAGKLLPN       300
     FIFVANIDSK DAQQIIAGNE KVVRPRLADA EFFFKTDRKQ RLEDNLPRLE SVLFQQQLGS       360
     LRDKTDRITA LAGWIAQQIG ADVNMATRAG LLSKCDLMTN MVFEFTDTQG VMGMHYARHD       420
     GEAEEVAVAL NEQYMPRFAG DALPTSLVAC AVAIADKMDT LAGIFGIGQH PKGDKDPFAL       480
     RRAALGVLRI VVEKKLPLDL LTLTQEAVRL YGDKLGNASV VDDVVEFMLG RFRAWYQEEG       540
     HAVDTIQAVL ARRPTRPADF DARVRAVSHF RTLPEAATLA AANKRVSNIL AKSGDVLAEQ       600
     VQAVLLKEPA EIRLAANLIT LQEKLAPLFA DGRYQEALVE LATLRQPVDD FFEQVMVMAD       660
     DEQVRINRLT LLNKLRDLFL QVADISVLQ                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page