(data stored in ACNUC7421 zone)

EMBL: CP001600.PE132

CP001600.PE132       Location/Qualifiers
FT   CDS             142364..142633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0143"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67398"
FT                   /db_xref="GOA:C5BCA7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA7"
FT                   /protein_id="ACR67398.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGD
FT                   DEKTPPSNTANSSAAPQDADFKSIVEQQPEVKKEESKSQNKEQV"
     MGGISIWQLL IIAVIVVLLF GTNKLRTLGS DLGASIKGFK KAIGDDEKTP PSNTANSSAA        60
     PQDADFKSIV EQQPEVKKEE SKSQNKEQV                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page