(data stored in ACNUC7421 zone)

EMBL: CP001600.PE133

CP001600.PE133       Location/Qualifiers
FT   CDS             142637..143167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0144"
FT                   /product="twin arginine-targeting protein translocase TatB,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67399"
FT                   /db_xref="GOA:C5BCA8"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA8"
FT                   /protein_id="ACR67399.1"
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPVAVRTVAGWIRALRSLATS
FT                   VQNELSQELKLQELQDSLKKAETAGLQNLTPELKASMDELKQAAESMKRSYHSEITGSD
FT                   TEKEPSAAETIPHADMMTKPEADVALAPRQSAVQDAPPVVQAVPSTHADAMTASAQPAS
FT                   SPSTSHDSSQHGR"
     MFDIGFSELL LVMVIGLVVL GPERLPVAVR TVAGWIRALR SLATSVQNEL SQELKLQELQ        60
     DSLKKAETAG LQNLTPELKA SMDELKQAAE SMKRSYHSEI TGSDTEKEPS AAETIPHADM       120
     MTKPEADVAL APRQSAVQDA PPVVQAVPST HADAMTASAQ PASSPSTSHD SSQHGR           176
//

If you have problems or comments...

PBIL Back to PBIL home page