(data stored in ACNUC7421 zone)

EMBL: CP001600.PE134

CP001600.PE134       Location/Qualifiers
FT   CDS             143157..143945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0145"
FT                   /product="twin arginine-targeting protein translocase TatC,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67400"
FT                   /db_xref="GOA:C5BCA9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA9"
FT                   /protein_id="ACR67400.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNAIICILVVFLALVYFANDIYHLV
FT                   SAPLINQLPHGASMIATDVASPFFTPIKLTMIVSVFVSAPFILYQVWAFVAPALYKHER
FT                   RMLTPLLVSSTLLFYIGMAFAYFVVFPLAFGFFAKTAPAGVTIATDINNYLDFVMALFM
FT                   AFGVSFEVPVAIILLCWTGVTTPAELKKKRPYVIVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   CLLFEVGVFFARFYVGKRRRDPEEEDEDEALHDEEQPKAG"
     MAVEDTQPLI SHLIELRKRL LNAIICILVV FLALVYFAND IYHLVSAPLI NQLPHGASMI        60
     ATDVASPFFT PIKLTMIVSV FVSAPFILYQ VWAFVAPALY KHERRMLTPL LVSSTLLFYI       120
     GMAFAYFVVF PLAFGFFAKT APAGVTIATD INNYLDFVMA LFMAFGVSFE VPVAIILLCW       180
     TGVTTPAELK KKRPYVIVGA FVVGMLLTPP DVFSQTLLAI PMCLLFEVGV FFARFYVGKR       240
     RRDPEEEDED EALHDEEQPK AG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page