(data stored in ACNUC7421 zone)

EMBL: CP001600.PE14

CP001600.PE14        Location/Qualifiers
FT   CDS             complement(14551..15459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0015"
FT                   /product="glycyl-tRNA synthetase, alpha subunit, putative"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67276"
FT                   /db_xref="GOA:C5B996"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B996"
FT                   /protein_id="ACR67276.1"
FT                   /translation="MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFAC
FT                   FEQYEKEARMLLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   MVAEAYYASREALGFPMCKKD"
     MQKFDIKTFQ GLILTLQDYW ARQGCTIVQP LDMEVGAGTS HPMTCLRALG PEPMATAYVQ        60
     PSRRPTDGRY GENPNRLQHY YQFQVVIKPS PDNIQELYLG SLKALGLDPT VHDIRFVEDN       120
     WENPTLGAWG LGWEVWLNGM EVTQFTYFQQ VGGLECKPVT GEITYGLERL AMYIQGVDSV       180
     YDLVWSDGPL GKTTYGDVFH QNEVEQSTYN FEYADVDFLF ACFEQYEKEA RMLLELEHPL       240
     PLPAYERILK AAHSFNLLDA RKAISVTERQ RYILRIRTLT KMVAEAYYAS REALGFPMCK       300
     KD                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page