(data stored in ACNUC7421 zone)

EMBL: CP001600.PE140

CP001600.PE140       Location/Qualifiers
FT   CDS             149113..149814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0151"
FT                   /product="oxidoreductase, FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67406"
FT                   /db_xref="GOA:C5BCB5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB5"
FT                   /protein_id="ACR67406.1"
FT                   /translation="MTTLSCKVTSVDAITDTVYRVRLVPERAVDFRAGQYLMVVMDERD
FT                   KRPFSMASTPLQSDCIELHIGASELNLYAMAVMDRILQDRTLCVDMPHGDAWLREDSLR
FT                   PLVLIAGGTGFSYTRSILLMALSQQPQREISLYWGGRELKHLYDLNELYALSARYPQLK
FT                   IIPTVEQPDADWQGRSGTVISAVMQDFGSLAQHDIYIAGRFEMAKIARERFCAEREANP
FT                   EHIYGDAFAFI"
     MTTLSCKVTS VDAITDTVYR VRLVPERAVD FRAGQYLMVV MDERDKRPFS MASTPLQSDC        60
     IELHIGASEL NLYAMAVMDR ILQDRTLCVD MPHGDAWLRE DSLRPLVLIA GGTGFSYTRS       120
     ILLMALSQQP QREISLYWGG RELKHLYDLN ELYALSARYP QLKIIPTVEQ PDADWQGRSG       180
     TVISAVMQDF GSLAQHDIYI AGRFEMAKIA RERFCAEREA NPEHIYGDAF AFI              233
//

If you have problems or comments...

PBIL Back to PBIL home page