(data stored in ACNUC7421 zone)

EMBL: CP001600.PE144

CP001600.PE144       Location/Qualifiers
FT   CDS             153424..153972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0155"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67410"
FT                   /db_xref="GOA:C5BCB9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB9"
FT                   /protein_id="ACR67410.1"
FT                   /translation="MKTLVLYSSHDGQTKAIATAIATAISETLDCELRDLEQAGDIDLN
FT                   AYQAVAIGAAVRYGHFPRALHRFASDHTPRLNTMPSAFFAINLTARKPEKRTPQTNGYT
FT                   RKFLLSTPWKPAQCVVFAGALRYPRYSWLDRTMIKMIMKMTGGETDTTKEVEYTDWQQV
FT                   DRFARDFARFVSTLAKKTP"
     MKTLVLYSSH DGQTKAIATA IATAISETLD CELRDLEQAG DIDLNAYQAV AIGAAVRYGH        60
     FPRALHRFAS DHTPRLNTMP SAFFAINLTA RKPEKRTPQT NGYTRKFLLS TPWKPAQCVV       120
     FAGALRYPRY SWLDRTMIKM IMKMTGGETD TTKEVEYTDW QQVDRFARDF ARFVSTLAKK       180
     TP                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page