(data stored in ACNUC7421 zone)

EMBL: CP001600.PE146

CP001600.PE146       Location/Qualifiers
FT   CDS             160698..161657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0161"
FT                   /product="bifunctional protein BirA , putative"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67413"
FT                   /db_xref="GOA:C5BCC2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC2"
FT                   /protein_id="ACR67413.1"
FT                   /translation="MKDITVPLKLISQLADGDFHSGEHLGESLGMSRAGINKHIQTLRD
FT                   WGIDVFTVPGKGYCLPTPMQLLNTETIGALLPQGRVTVLPVVDSTNQYLLERIGELASG
FT                   DACVAEYQQAGRGRRGRHWFSPFGANLYLSMYWRLEQGPAAAMGLSLVIGIVMAEVLQA
FT                   LGAAGVKVKWPNDLYLNDRKLAGILVELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQ
FT                   WINLQEAGVNIDRNQLVACLLSRLRSTLADFEVRGLSPFISRWRVLDNFVDRPVRLIIG
FT                   EQVIHGIARGIDAQGALLLERDGVITPFIGGEISLRAG"
     MKDITVPLKL ISQLADGDFH SGEHLGESLG MSRAGINKHI QTLRDWGIDV FTVPGKGYCL        60
     PTPMQLLNTE TIGALLPQGR VTVLPVVDST NQYLLERIGE LASGDACVAE YQQAGRGRRG       120
     RHWFSPFGAN LYLSMYWRLE QGPAAAMGLS LVIGIVMAEV LQALGAAGVK VKWPNDLYLN       180
     DRKLAGILVE LTGKTGDAAN IVVGAGINLM MRNPDTSVVD QQWINLQEAG VNIDRNQLVA       240
     CLLSRLRSTL ADFEVRGLSP FISRWRVLDN FVDRPVRLII GEQVIHGIAR GIDAQGALLL       300
     ERDGVITPFI GGEISLRAG                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page