(data stored in ACNUC7421 zone)

EMBL: CP001600.PE147

CP001600.PE147       Location/Qualifiers
FT   CDS             complement(161732..162679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0162"
FT                   /product="pantothenate kinase, putative"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67414"
FT                   /db_xref="GOA:C5BCC3"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC3"
FT                   /protein_id="ACR67414.1"
FT                   /translation="MKKEQSLATPYLQFDRHQWAALRNSVPLTLTEEEIARLKGINEDL
FT                   SLDEVAQIYLPLSRLLNFYFSSSVSRQVVLEKFLGTHSPRIPYIIGIAGSVAVGKSTTA
FT                   RVLQALLSRWPEHRRVELITTDGFLHPNKILQERGLMKKKGFPQSYDMHHLVKFVSDIK
FT                   SGVSQVTAPQYSHLIYDVLPDSRKLIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDFV
FT                   DFSIYVDADEHQLQAWYINRFLKFREGAFSNPDSYFHHYSQLPESEAIAIATGLWNEIN
FT                   GLNLRQNILPTRERASLIMTKGSNHAIESVRLRK"
     MKKEQSLATP YLQFDRHQWA ALRNSVPLTL TEEEIARLKG INEDLSLDEV AQIYLPLSRL        60
     LNFYFSSSVS RQVVLEKFLG THSPRIPYII GIAGSVAVGK STTARVLQAL LSRWPEHRRV       120
     ELITTDGFLH PNKILQERGL MKKKGFPQSY DMHHLVKFVS DIKSGVSQVT APQYSHLIYD       180
     VLPDSRKLIE QPDILILEGL NVLQSGMDYP HDPHRVFVSD FVDFSIYVDA DEHQLQAWYI       240
     NRFLKFREGA FSNPDSYFHH YSQLPESEAI AIATGLWNEI NGLNLRQNIL PTRERASLIM       300
     TKGSNHAIES VRLRK                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page