(data stored in ACNUC7421 zone)

EMBL: CP001600.PE149

CP001600.PE149       Location/Qualifiers
FT   CDS             165181..165564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0168"
FT                   /product="preprotein translocase, SecE subunit , putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67416"
FT                   /db_xref="GOA:C5BHD8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD8"
FT                   /protein_id="ACR67416.2"
FT                   /translation="MSANTDAQGSGRGLEVMKWLVVAVLLIVAIVGNYIYRDVSLPLRA
FT                   LAVVVIIAAAGGIALMTTQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVM
FT                   ALILWGLDGVLVRLVSFITGLRF"
     MSANTDAQGS GRGLEVMKWL VVAVLLIVAI VGNYIYRDVS LPLRALAVVV IIAAAGGIAL        60
     MTTQGKATVA FAREARTEMR KVIWPTRQEA LHTTLIVAAV TAVMALILWG LDGVLVRLVS       120
     FITGLRF                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page