(data stored in ACNUC7421 zone)

EMBL: CP001600.PE151

CP001600.PE151       Location/Qualifiers
FT   CDS             166276..166704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0170"
FT                   /product="50S ribosomal protein L11, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67418"
FT                   /db_xref="GOA:C5BHE0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE0"
FT                   /protein_id="ACR67418.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKDKVGKVTRA
FT                   QVREIAETKAADMTGADVEAMARSIEGTARSMGLVVED"
     MAKKVQAYVK LQVAAGMANP SPPVGPALGQ QGVNIMEFCK AFNAKTDSIE KGLPIPVVIT        60
     VYSDRSFTFV TKTPPAAVLL KKAAGVKSGS GKPNKDKVGK VTRAQVREIA ETKAADMTGA       120
     DVEAMARSIE GTARSMGLVV ED                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page