(data stored in ACNUC7421 zone)

EMBL: CP001600.PE152

CP001600.PE152       Location/Qualifiers
FT   CDS             166708..167412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0171"
FT                   /product="50S ribosomal protein L1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67419"
FT                   /db_xref="GOA:C5BHE1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE1"
FT                   /protein_id="ACR67419.1"
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAVALLQELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRTVRVAVFTQGPNAEAAKAAGADLVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHSTIGKASFSAEQLKENLEALMVALKKAKPATAKGVYIKKVCLSTTMGAGV
FT                   TIDQATLSAVAN"
     MAKLTKRMRV IREKVDATKQ YDINEAVALL QELATAKFVE SVDVAVNLGI DARKSDQNVR        60
     GATVLPHGTG RTVRVAVFTQ GPNAEAAKAA GADLVGMEDL ADQIKKGEMN FDVVIASPDA       120
     MRVVGQLGQI LGPRGLMPNP KVGTVTPNVA EAVKNAKAGQ VRYRNDKNGI IHSTIGKASF       180
     SAEQLKENLE ALMVALKKAK PATAKGVYIK KVCLSTTMGA GVTIDQATLS AVAN             234
//

If you have problems or comments...

PBIL Back to PBIL home page