(data stored in ACNUC7421 zone)

EMBL: CP001600.PE153

CP001600.PE153       Location/Qualifiers
FT   CDS             167729..168226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0172"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67420"
FT                   /db_xref="GOA:C5BHE2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE2"
FT                   /protein_id="ACR67420.1"
FT                   /translation="MALNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
     MALNLQDKQA IVAEVTEVAK GALSAVVADS RGVTVDKMTE LRKAGREAGV YMRVVRNTLM        60
     RRVVEGSQFE CLKDTFVGPT LIAFSMEHPG AAARLFKAFA KDNAKFEVKA AAFEGELIPA       120
     AQIDRLATLP TYEEAIARLM ATMKEAAAGK LVRTLAALRD QKEAA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page