(data stored in ACNUC7421 zone)

EMBL: CP001600.PE154

CP001600.PE154       Location/Qualifiers
FT   CDS             168993..173021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0174"
FT                   /product="DNA-directed RNA polymerase, beta subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67421"
FT                   /db_xref="GOA:C5BHE3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE3"
FT                   /protein_id="ACR67421.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALDFTTEQILD
FT                   LFFDKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VTLIEVPVEYIVGKVAAKDYIDESTGELICAANMELSLDLLAKLSQSGYKRIDTLFTND
FT                   LDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLMRDEIEGSGILSKNDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDMLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGIVTDEIHYLSAIEEGNFVIAQANSNLDDEGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGMVQYVDASRIVIKVNEDEMFPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTSIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHDVLVAGGVEAEKL
FT                   EKLPRDRWLELGLADEAKQNQLEQLAEQYDELKAEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGDNTRQQVDLNTFSD
FT                   DEVLRLAENLKKGLPVATPVFDGAKEREIKGLLELGGIPTSGQITLYDGRTGERFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGSHQMEPGMPESFNVLLKEIRSLGINIELEDE"
     MVYSYTEKKR IRKDFGKRPQ VLDVPYLLSI QLDSFQKFIE QDPEGQYGLE AAFRSVFPIQ        60
     SYSGNSELQY VSYRLGEPVF DVKECQIRGV TYSAPLRVKL RLVIYEREAP EGTVKDIKEQ       120
     EVYMGEIPLM TENGTFVING TERVIVSQLH RSPGVFFDSD KGKTHSSGKV LYNARIIPYR       180
     GSWLDFEFDP KDNLFVRIDR RRKLPATIIL RALDFTTEQI LDLFFDKVIF EIRDNKLQME       240
     LVPERLRGET ASFDIEANGK VYVEKGRRIT ARHIRQLEKD DVTLIEVPVE YIVGKVAAKD       300
     YIDESTGELI CAANMELSLD LLAKLSQSGY KRIDTLFTND LDHGPYMSET LRVDPTNDRL       360
     SALVEIYRMM RPGEPPTREA AENLFENLFF SEDRYDLSAV GRMKFNRSLM RDEIEGSGIL       420
     SKNDIIEVMK KLIDIRNGKG EVDDIDHLGN RRIRSVGEMA ENQFRVGLVR VERAVKERLS       480
     LGDLDMLMPQ DMINAKPISA AVKEFFGSSQ LSQFMDQNNP LSEITHKRRI SALGPGGLTR       540
     ERAGFEVRDV HPTHYGRVCP IETPEGPNIG LINSLSVYAQ TNEYGFLETP YRRVRDGIVT       600
     DEIHYLSAIE EGNFVIAQAN SNLDDEGRFV EDLVTCRSKG ESSLFSRDQV DYMDVSTQQV       660
     VSVGASLIPF LEHDDANRAL MGANMQRQAV PTLRADKPLV GTGMERAVAV DSGVTSVAKR       720
     GGMVQYVDAS RIVIKVNEDE MFPGEAGIDI YNLTKYTRSN QNTCISQMPC VSLGEPIERG       780
     DVLADGPSTD LGELALGQNM RVAFMPWNGY NFEDSILVSE RVVQEDRFTS IHIQELACVS       840
     RDTKLGPEEI TADIPNVGEA ALSKLDESGI VYIGAEVKGG DILVGKVTPK GETQLTPEEK       900
     LLRAIFGEKA SDVKDSSLRV PNSVSGTVID VQVFTRDGVE KDKRALEIEE MQLKQAKKDL       960
     TEELQILEAG LFARIHDVLV AGGVEAEKLE KLPRDRWLEL GLADEAKQNQ LEQLAEQYDE      1020
     LKAEFEKKLE AKRRKITQGD DLAPGVLKIV KVYLAVKRQI QPGDKMAGRH GNKGVISKIN      1080
     PIEDMPYDEN GTPVDIVLNP LGVPSRMNIG QILETHLGMA AKGIGDKINA MLKQQQEVAK      1140
     LREFIQRAYD LGDNTRQQVD LNTFSDDEVL RLAENLKKGL PVATPVFDGA KEREIKGLLE      1200
     LGGIPTSGQI TLYDGRTGER FERQVTVGYM YMLKLNHLVD DKMHARSTGS YSLVTQQPLG      1260
     GKAQFGGQRF GEMEVWALEA YGAAYTLQEM LTVKSDDVNG RTKMYKNIVD GSHQMEPGMP      1320
     ESFNVLLKEI RSLGINIELE DE                                               1342
//

If you have problems or comments...

PBIL Back to PBIL home page