(data stored in ACNUC7421 zone)

EMBL: CP001600.PE155

CP001600.PE155       Location/Qualifiers
FT   CDS             173101..177321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0175"
FT                   /product="DNA-directed RNA polymerase, beta' subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67422"
FT                   /db_xref="GOA:C5BHE4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE4"
FT                   /protein_id="ACR67422.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKGMDLEAECEQLREELGETNSETKRKKLTKRIK
FT                   LLEAFILSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITQYSKSADGEMVPNTGLIDTTVGR
FT                   AILWMIVPKGLPYSIVNQPLGKKAISKMLNACYRALGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSSETVINRDGEEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVLKPGTADILVPRNTLLNEKWCDL
FT                   LEEHSVDSVKVRSVVSCETDFGVCAHCYGRDLARGHLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGNLKLSNAKFVVNSDGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGATLAKGDSAEVNGGETVANWDPHTMPVITEVSGFIRFADMIDGQTVTR
FT                   QTDELTGLSSQVVLDSAERTGSGKDLRPALKIVDANGDDVLLPGTDMPAQYFLPGKAIV
FT                   QLEDGIAISAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGVVSFG
FT                   KETKGKRRLVITPLDGSDTYEEMIPKWRQLNVFEGERVERGDVISDGPESPHDILRLRG
FT                   VNAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIANAGSSEFLEGEQVEVSR
FT                   VKIANRLLESDGKIAATYMRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRSTDTSSAPQVSAEEASANLAELLNAGLLG
FT                   GNDE"
     MKDLLKFLKA QTKTEEFDAI KIALASPDMI RSWSFGEVKK PETINYRTFK PERDGLFCAR        60
     IFGPVKDYEC LCGKYKRLKH RGVICEKCGV EVTQTKVRRE RMGHIELASP TAHIWFLKSL       120
     PSRIGLLLDM PLRDIERVLY FESYVVVEGG MTNLERRQIL TEEQYLDALE EFGDEFDAKM       180
     GAEAIQALLK GMDLEAECEQ LREELGETNS ETKRKKLTKR IKLLEAFILS GNKPEWMILT       240
     VLPVLPPDLR PLVPLDGGRF ATSDLNDLYR RVINRNNRLK RLLDLAAPDI IVRNEKRMLQ       300
     EAVDALLDNG RRGRAITGSN KRPLKSLADM IKGKQGRFRQ NLLGKRVDYS GRSVITVGPY       360
     LRLHQCGLPK KMALELFKPF IYGKLELRGL ATTIKAAKKM VEREEAVVWD ILDEVIREHP       420
     VMLNRAPTLH RLGIQAFEPL LIEGKAIQLH PLVCAAYNAD FDGDQMAVHV PLTLEAQLEA       480
     RALMMSTNNI LSPANGDPII VPSQDVVLGL YYMTRDCVNA KGEGMVLSGP KEAERIYRAG       540
     LASLHARVKV RITQYSKSAD GEMVPNTGLI DTTVGRAILW MIVPKGLPYS IVNQPLGKKA       600
     ISKMLNACYR ALGLKPTVIF ADQIMYTGFA YAARSGASVG IDDMVIPEKK AGIIAEAEAE       660
     VAEIQEQFQS GLVTAGERYN KVIDIWAAAN ERVAKAMMEN LSSETVINRD GEEERQVSFN       720
     SIFMMADSGA RGSAAQIRQL AGMRGLMAKP DGSIIETPIT ANFREGLNVL QYFISTHGAR       780
     KGLADTALKT ANSGYLTRRL VDVAQDLVVI EDDCGTHNGI VMTPVIEGGD VKEPLRDRVL       840
     GRVTAEEVLK PGTADILVPR NTLLNEKWCD LLEEHSVDSV KVRSVVSCET DFGVCAHCYG       900
     RDLARGHLVN KGEAIGVIAA QSIGEPGTQL TMRTFHIGGA ASRAAAESSI QVKNKGNLKL       960
     SNAKFVVNSD GKLVITSRNT ELKLIDEFGR TKESYKVPYG ATLAKGDSAE VNGGETVANW      1020
     DPHTMPVITE VSGFIRFADM IDGQTVTRQT DELTGLSSQV VLDSAERTGS GKDLRPALKI      1080
     VDANGDDVLL PGTDMPAQYF LPGKAIVQLE DGIAISAGDT LARIPQESGG TKDITGGLPR      1140
     VADLFEARRP KEPAILAEIS GVVSFGKETK GKRRLVITPL DGSDTYEEMI PKWRQLNVFE      1200
     GERVERGDVI SDGPESPHDI LRLRGVNAVT RYIVNEVQDV YRLQGVKIND KHIEVIVRQM      1260
     LRKATIANAG SSEFLEGEQV EVSRVKIANR LLESDGKIAA TYMRDLLGIT KASLATESFI      1320
     SAASFQETTR VLTEAAVAGK RDELRGLKEN VIVGRLIPAG TGYAYHQDRM RRRSTDTSSA      1380
     PQVSAEEASA NLAELLNAGL LGGNDE                                           1406
//

If you have problems or comments...

PBIL Back to PBIL home page