(data stored in ACNUC7421 zone)

EMBL: CP001600.PE157

CP001600.PE157       Location/Qualifiers
FT   CDS             complement(178073..180004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0177"
FT                   /product="thiamine biosynthesis protein ThiC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67424"
FT                   /db_xref="GOA:C5BHE6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE6"
FT                   /protein_id="ACR67424.1"
FT                   /translation="MSTLTHSDAPRRQRRAQAQAFIDNLQAQAFPSSQRIYLQGSRADI
FT                   RVPLREITLSPTLIGGTPEQPQWRDNEAIAVYDTSGAYGDQQAEIDLRRGLPGIRCAWI
FT                   AERNDSEILPGRSSDYTRRRQADQDLETLRFELRSPARRARPGHRVTQLHYARQGIITP
FT                   EMEFIALRENMGRERIRSAILRQQHPGIAFGAHLPDNITPAFVRDEVAAGRAIIPANIN
FT                   HPESEPMIIGRNFLVKVNANIGSSSVTSSIEEEVEKLVWATRWGADTVMDLSTGRYIHE
FT                   TREWILRNSPVPIGTVPIYQALEKVNGIAENLDWPLVRDTLLEQAEQGVDYFTLHAGLL
FT                   LRFIPMTAERLTGIVSRGGAIMAKWCLSHHQENFLYTHFREICEICSAYDIALSLGDGL
FT                   RPGSIQDANDQAQFAELHTLGELTQIAWEYDVQVMIEGPGHVPMHMIQRNMEEELNHCH
FT                   EAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCALLCYVTPKEHLGLPDKDDVKQGL
FT                   ITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPVTARAYHDATLPQA
FT                   SGKLAHFCSMCGPKFCSMKISREVREHAARQQEAEPGMAQMAQQFREQGGDIYLTNIAD
FT                   NAPLHKEP"
     MSTLTHSDAP RRQRRAQAQA FIDNLQAQAF PSSQRIYLQG SRADIRVPLR EITLSPTLIG        60
     GTPEQPQWRD NEAIAVYDTS GAYGDQQAEI DLRRGLPGIR CAWIAERNDS EILPGRSSDY       120
     TRRRQADQDL ETLRFELRSP ARRARPGHRV TQLHYARQGI ITPEMEFIAL RENMGRERIR       180
     SAILRQQHPG IAFGAHLPDN ITPAFVRDEV AAGRAIIPAN INHPESEPMI IGRNFLVKVN       240
     ANIGSSSVTS SIEEEVEKLV WATRWGADTV MDLSTGRYIH ETREWILRNS PVPIGTVPIY       300
     QALEKVNGIA ENLDWPLVRD TLLEQAEQGV DYFTLHAGLL LRFIPMTAER LTGIVSRGGA       360
     IMAKWCLSHH QENFLYTHFR EICEICSAYD IALSLGDGLR PGSIQDANDQ AQFAELHTLG       420
     ELTQIAWEYD VQVMIEGPGH VPMHMIQRNM EEELNHCHEA PFYTLGPLTT DIAPGYDHFT       480
     SGIGAAMIGW FGCALLCYVT PKEHLGLPDK DDVKQGLITY KIAAHAADLA KGHPGAQIRD       540
     NAMSKARFEF RWEDQFNLAL DPVTARAYHD ATLPQASGKL AHFCSMCGPK FCSMKISREV       600
     REHAARQQEA EPGMAQMAQQ FREQGGDIYL TNIADNAPLH KEP                         643
//

If you have problems or comments...

PBIL Back to PBIL home page