(data stored in ACNUC7421 zone)

EMBL: CP001600.PE161

CP001600.PE161       Location/Qualifiers
FT   CDS             183091..183681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0182"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function, DUF"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67428"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF0"
FT                   /protein_id="ACR67428.1"
FT                   /translation="MLRNPIHKRLEKLESWQQLTFMACLTERMYPNYQAFCQQSAFGEA
FT                   AVYRRILDLVWELLTVKDVKINFDSQLEKLEAAIPDADTYDMYGVYPAIDACVALSEIL
FT                   HAQLGGEMLAHAIAVSETSLHTVGMLEMTQSGWEMSDDELKTLPAIQDELDIQWEIYRL
FT                   LSEAEERDLELIKGLRADLREAGVSNIGIELAQ"
     MLRNPIHKRL EKLESWQQLT FMACLTERMY PNYQAFCQQS AFGEAAVYRR ILDLVWELLT        60
     VKDVKINFDS QLEKLEAAIP DADTYDMYGV YPAIDACVAL SEILHAQLGG EMLAHAIAVS       120
     ETSLHTVGML EMTQSGWEMS DDELKTLPAI QDELDIQWEI YRLLSEAEER DLELIKGLRA       180
     DLREAGVSNI GIELAQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page