(data stored in ACNUC7421 zone)

EMBL: CP001600.PE162

CP001600.PE162       Location/Qualifiers
FT   CDS             183871..184143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0183"
FT                   /product="DNA-binding protein HU-alpha, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67429"
FT                   /db_xref="GOA:C5BHF1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF1"
FT                   /protein_id="ACR67429.1"
FT                   /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKAGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     MNKTQLIDVI ADKADLSKAQ AKAALESTLA AITESLKAGD AVQLVGFGTF KVNHRNERTG        60
     RNPQTGKEIK IAAANVPAFV SGKALKDAVK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page