(data stored in ACNUC7421 zone)

EMBL: CP001600.PE163

CP001600.PE163       Location/Qualifiers
FT   CDS             184187..184861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0184"
FT                   /product="Protein of unknown function (DUF1481)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67430"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF2"
FT                   /protein_id="ACR67430.2"
FT                   /translation="MTPLLSMCHRVRGLLPVALLLTGCHSAVPVAPFTATGYIADGGIV
FT                   RLWRLEGAGHQPQAMMRVFTPLDGTETQIDRYTYRAGYLYQILQQTGQGNDDVLQLRFD
FT                   MQGALSYMQRLRNGSKEMPGSDEVAKAQYQARHAQEMAATLVAGGVNLIQGRWQGGIFT
FT                   RCDGQVSPLPLSGWQAAQLARREANSRGPLWVAWLSAPEGAQLLQVANHNICAWAPTEK
FT                   TV"
     MTPLLSMCHR VRGLLPVALL LTGCHSAVPV APFTATGYIA DGGIVRLWRL EGAGHQPQAM        60
     MRVFTPLDGT ETQIDRYTYR AGYLYQILQQ TGQGNDDVLQ LRFDMQGALS YMQRLRNGSK       120
     EMPGSDEVAK AQYQARHAQE MAATLVAGGV NLIQGRWQGG IFTRCDGQVS PLPLSGWQAA       180
     QLARREANSR GPLWVAWLSA PEGAQLLQVA NHNICAWAPT EKTV                        224
//

If you have problems or comments...

PBIL Back to PBIL home page