(data stored in ACNUC7421 zone)

EMBL: CP001600.PE165

CP001600.PE165       Location/Qualifiers
FT   CDS             complement(186215..187804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0186"
FT                   /product="bifunctional purine biosynthesis protein,
FT                   putative"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67432"
FT                   /db_xref="GOA:C5BHF4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF4"
FT                   /protein_id="ACR67432.1"
FT                   /translation="MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLS
FT                   QAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVN
FT                   LYPFAQTVARPDCSQEDAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFENIIAEMDAH
FT                   HGALTQATRFDLAIKAFEHTAAYDSMIANYFGSLVAPYHGDIHSPSGRFPRTLNLNLVK
FT                   KQDMRYGENGHQQAAFYIEEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFTEP
FT                   ACVIVKHANPCGVALGDDLFDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIITRQFV
FT                   EVIIAPHVTEDALDLLSAKQNVRVLACDEWDVRVPGLDFKRVNGGLLVQDRDLDMVDAA
FT                   DLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLQIAGSVMASDAFFPFRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHDI
FT                   AMIFTGMRHFRH"
     MQHSRPVRRA LLSVSDKSGI VEFAQALHLR GVELLSTGGT ARLLSQAGLP VTEVSDYTGF        60
     PEMMDGRVKT LHPKVHGGIL GRRDRDAAVM QQHGIQPIDM VVVNLYPFAQ TVARPDCSQE       120
     DAVENIDIGG PTMVRSAAKN HNDVAIVVNN GDFENIIAEM DAHHGALTQA TRFDLAIKAF       180
     EHTAAYDSMI ANYFGSLVAP YHGDIHSPSG RFPRTLNLNL VKKQDMRYGE NGHQQAAFYI       240
     EEPQVEACIA TAQQLQGKAL SYNNIADTDA ALECVKSFTE PACVIVKHAN PCGVALGDDL       300
     FDAYERAYQT DPTSAFGGII AFNRTLDAKT AQAIITRQFV EVIIAPHVTE DALDLLSAKQ       360
     NVRVLACDEW DVRVPGLDFK RVNGGLLVQD RDLDMVDAAD LRVVTERQPS EQELRDALFC       420
     WKVAKFVKSN AIVYARDNMT VGIGAGQMSR VYSAKIAGIK AADEGLQIAG SVMASDAFFP       480
     FRDGIDAAAA VGIRCVIQPG GSIRDDEVIA AANEHDIAMI FTGMRHFRH                   529
//

If you have problems or comments...

PBIL Back to PBIL home page