(data stored in ACNUC7421 zone)

EMBL: CP001600.PE169

CP001600.PE169       Location/Qualifiers
FT   CDS             197894..198007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67437"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF9"
FT                   /protein_id="ACR67437.1"
FT                   /translation="MLADFIGCRNIAKFASGFINCQFIDHTTEYYCLIICV"
     MLADFIGCRN IAKFASGFIN CQFIDHTTEY YCLIICV                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page