(data stored in ACNUC7421 zone)

EMBL: CP001600.PE174

CP001600.PE174       Location/Qualifiers
FT   CDS             201311..201493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0199"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67442"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y0"
FT                   /protein_id="ACR67442.1"
FT                   /translation="MELCAIQQISQFKARYDNPNKKLHQCDEKHQINWISANGCSAGLA
FT                   QMQGVFLTVHFDLSV"
     MELCAIQQIS QFKARYDNPN KKLHQCDEKH QINWISANGC SAGLAQMQGV FLTVHFDLSV        60
//

If you have problems or comments...

PBIL Back to PBIL home page