(data stored in ACNUC7421 zone)

EMBL: CP001600.PE175

CP001600.PE175       Location/Qualifiers
FT   CDS             201541..202368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0200"
FT                   /product="Calcineurin-like phosphoesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67443"
FT                   /db_xref="GOA:C5B6Y1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y1"
FT                   /protein_id="ACR67443.1"
FT                   /translation="MESLFHLAVASGAPVRLLQITDTHLFAGQQETLLGVNTYRSYQAV
FT                   LAAIRAEAHPFDLIVATGDLAQDHSAAAYRHFAAGVAELHRPCLWLPGNHDFQPAMVDA
FT                   LAQAGVHANKRALLGECWQIVLLDSQVVGVPHGELSDYQLEWLELTLASEPQRHTMLLL
FT                   HHHPQPSGCTWLDQHSLRNAHALDEILRRYPQVNTLVCGHIHQELDLDWNGRRLLATPS
FT                   TCVQFKPLCTNFTIDTISPGWRYLTLYPDGRVTTAVHRLASSEFRPDLDADGY"
     MESLFHLAVA SGAPVRLLQI TDTHLFAGQQ ETLLGVNTYR SYQAVLAAIR AEAHPFDLIV        60
     ATGDLAQDHS AAAYRHFAAG VAELHRPCLW LPGNHDFQPA MVDALAQAGV HANKRALLGE       120
     CWQIVLLDSQ VVGVPHGELS DYQLEWLELT LASEPQRHTM LLLHHHPQPS GCTWLDQHSL       180
     RNAHALDEIL RRYPQVNTLV CGHIHQELDL DWNGRRLLAT PSTCVQFKPL CTNFTIDTIS       240
     PGWRYLTLYP DGRVTTAVHR LASSEFRPDL DADGY                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page