(data stored in ACNUC7421 zone)

EMBL: CP001600.PE176

CP001600.PE176       Location/Qualifiers
FT   CDS             202371..202952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0201"
FT                   /product="Uncharacterized protein family (UPF0227)"
FT                   /note="Uncharacterised protein family (UPF0227)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67444"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y2"
FT                   /protein_id="ACR67444.1"
FT                   /translation="MPTLLYLHGFNSSPRSAKAMALQCWLAEHHPQITMLIPQLPPYPA
FT                   DAAQMLEELVMERAGRPLGLVGSSLGGYYATWLSQCFTLPAVVINPAVKPFELLLDFLG
FT                   QNENPYTGQQYVLESRHVFDLKVMQVDPLESPDLIWLLQQTGDEVLDYRQAVTYYTPCR
FT                   QTIEEGGNHAFAGIERFFPQIIDFLGLSAE"
     MPTLLYLHGF NSSPRSAKAM ALQCWLAEHH PQITMLIPQL PPYPADAAQM LEELVMERAG        60
     RPLGLVGSSL GGYYATWLSQ CFTLPAVVIN PAVKPFELLL DFLGQNENPY TGQQYVLESR       120
     HVFDLKVMQV DPLESPDLIW LLQQTGDEVL DYRQAVTYYT PCRQTIEEGG NHAFAGIERF       180
     FPQIIDFLGL SAE                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page