(data stored in ACNUC7421 zone)

EMBL: CP001600.PE177

CP001600.PE177       Location/Qualifiers
FT   CDS             203059..204954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0202"
FT                   /product="DNA topoisomerase IV, B subunit, putative"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67445"
FT                   /db_xref="GOA:C5B6Y3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y3"
FT                   /protein_id="ACR67445.1"
FT                   /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHATRIEVILHPDQSLEVIDNGRGMPVDIHPEEGVPAIELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSRRVEVSVRRDGQIYQMAFENGEKVEDLHVSGTVGRRNTG
FT                   TSVHFWPDAQFFDSARFSVSRLTHLLKAKAVLCPGVEILFRDLVNGSEQRWCYQDGLTD
FT                   YLMESVNGLVTLPEQPFTGTFASDTEAVDWALLWLPEGGELLTESYVNLIPTPQGGTHV
FT                   NGLRQGLLDAMREFCEFRNLLPRGVKLTADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQSAELLAELAINSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKVCILADADSDGLHIATLLCALFVRHFRPLVQA
FT                   GHVYVAMPPLYRIDLGKEVFYALSEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLAIEDEDMERTVAVMDMLLAKKRAEDRRNWLQENGNLAELDV"
     MTQSSYNADA IEVLSGLEPV RRRPGMYTDT TRPNHLGQEV IDNSVDEALA GHATRIEVIL        60
     HPDQSLEVID NGRGMPVDIH PEEGVPAIEL ILCRLHAGGK FSNKNYQFSG GLHGVGISVV       120
     NALSRRVEVS VRRDGQIYQM AFENGEKVED LHVSGTVGRR NTGTSVHFWP DAQFFDSARF       180
     SVSRLTHLLK AKAVLCPGVE ILFRDLVNGS EQRWCYQDGL TDYLMESVNG LVTLPEQPFT       240
     GTFASDTEAV DWALLWLPEG GELLTESYVN LIPTPQGGTH VNGLRQGLLD AMREFCEFRN       300
     LLPRGVKLTA DDIWERCAYV LSVKMQDPQF AGQTKERLSS RQCAAFVSGV VKDAFSLWLN       360
     QNVQSAELLA ELAINSAQRR MRAAKKVVRK KLTSGPALPG KLADCSAQDL NRTELFLVEG       420
     DSAGGSAKQA RDREYQAIMP LKGKILNTWE VSSDEVLASQ EVHDISVAIG IDPDSDDLSQ       480
     LRYGKVCILA DADSDGLHIA TLLCALFVRH FRPLVQAGHV YVAMPPLYRI DLGKEVFYAL       540
     SEEEKAGVLE QLKRKKGKPN VQRFKGLGEM NPLQLRETTL DPNTRRLVQL AIEDEDMERT       600
     VAVMDMLLAK KRAEDRRNWL QENGNLAELD V                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page