(data stored in ACNUC7421 zone)

EMBL: CP001600.PE178

CP001600.PE178       Location/Qualifiers
FT   CDS             205140..207422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0203"
FT                   /product="DNA topoisomerase IV, A subunit, putative"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67446"
FT                   /db_xref="GOA:C5B6Y4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y4"
FT                   /protein_id="ACR67446.1"
FT                   /translation="MSDLTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTE
FT                   AEIITPRDEIHKIYRTGRGSVRMRAVWRKEEGEIVISALPHQTSGAKVLEQIASQMRAK
FT                   KLPMVDDLRDESDHENPTRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDR
FT                   RPAVKDLREILSEWLSYRRETVRRRLNYRLEKVLKRLHILDGLLCAFLNIDEVIHIIRS
FT                   EDEPKPVLVARFGLSDTQAEAILELKLRHLARLEEVKIRGEQDELAQERDRLQTLLASE
FT                   RKLGTLIKKEIMADAETYGDARRSPLQERSEARAMSEHDFVPNEPVTIVLSEGGWVRSA
FT                   KGHDIDPSGLNYKAGDAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAADDQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENANVL
FT                   TPLEINGDDDMLLAITEAGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLL
FT                   VLAPQTSLTLHIGKRKLVMKPQDLQKFRAERGRKGTLLPRGLQRIERVDVDAPLSLRLD
FT                   ADAEGDA"
     MSDLTHDNSE RVALHAFTED AYLQYSMYVI MDRALPFIGD GLKPVQRRIV YAMSELGLSA        60
     SAKFKKSART VGDVLGKYHP HGDSACYEAM VLMAQPFSYR YPLVDGQGNW GAPDDPKSFA       120
     AMRYTESRLS RYAEILLSEL GQGTVDYVAN FDGTLQEPKF LPARLPNILL NGTTGIAVGM       180
     ATDIPPHNAR EVAAALVALL DNPQSSLDDL LTHIQGPDFP TEAEIITPRD EIHKIYRTGR       240
     GSVRMRAVWR KEEGEIVISA LPHQTSGAKV LEQIASQMRA KKLPMVDDLR DESDHENPTR       300
     LVIVPRSNRV DLDQLMNHLF ATTDLEKSYR INMNMIGLDR RPAVKDLREI LSEWLSYRRE       360
     TVRRRLNYRL EKVLKRLHIL DGLLCAFLNI DEVIHIIRSE DEPKPVLVAR FGLSDTQAEA       420
     ILELKLRHLA RLEEVKIRGE QDELAQERDR LQTLLASERK LGTLIKKEIM ADAETYGDAR       480
     RSPLQERSEA RAMSEHDFVP NEPVTIVLSE GGWVRSAKGH DIDPSGLNYK AGDAFRAAAR       540
     GKSNQPVVFI DSSGRSYALD PLTLPSARGQ GEPLTGKLTP PPGATIEHVL MAADDQKLLM       600
     ASDAGYGFVC TFSDLVARNR AGKAMLTLPE NANVLTPLEI NGDDDMLLAI TEAGRMLMFP       660
     VHDLPQLSKG KGNKIVSIPA AQAAAGEDTL KWLLVLAPQT SLTLHIGKRK LVMKPQDLQK       720
     FRAERGRKGT LLPRGLQRIE RVDVDAPLSL RLDADAEGDA                             760
//

If you have problems or comments...

PBIL Back to PBIL home page