(data stored in ACNUC7421 zone)

EMBL: CP001600.PE18

CP001600.PE18        Location/Qualifiers
FT   CDS             16934..17458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0020"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67280"
FT                   /db_xref="GOA:C5B9A0"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A0"
FT                   /protein_id="ACR67280.1"
FT                   /translation="MSSVALAEIGDKTQLLTLLLVARFGKPVLILLAIILATLVNHYFA
FT                   ALIGELVTQFLSPQIMRWMVAAGFLVMAVWVLFPDKNDGEIRGGHPFWTSLAVFFLAEI
FT                   GDKTQIATVLLGAHYQHITWVVLGSTLGMVLANAPMLWFGARLQPYLKSGWGRRLSSLL
FT                   FFILGVVTLIL"
     MSSVALAEIG DKTQLLTLLL VARFGKPVLI LLAIILATLV NHYFAALIGE LVTQFLSPQI        60
     MRWMVAAGFL VMAVWVLFPD KNDGEIRGGH PFWTSLAVFF LAEIGDKTQI ATVLLGAHYQ       120
     HITWVVLGST LGMVLANAPM LWFGARLQPY LKSGWGRRLS SLLFFILGVV TLIL             174
//

If you have problems or comments...

PBIL Back to PBIL home page