(data stored in ACNUC7421 zone)

EMBL: CP001600.PE185

CP001600.PE185       Location/Qualifiers
FT   CDS             complement(217612..218859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0211"
FT                   /product="Dicarboxylate/amino acid:cation (Na+ or H+)
FT                   symporter (DAACS) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67454"
FT                   /db_xref="GOA:C5B6Z2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z2"
FT                   /protein_id="ACR67454.1"
FT                   /translation="MHILRHYTFTLCLLLGIILGGLAGVLFGERATLVQPIGELFLNLM
FT                   FVVIVPLVFLSIASSIADMRQMSRLGKIMGTVFSVFIATALFAALIGFVATHLFNPFHN
FT                   VDTRSLIAHLPPTPQGQGKGVGEVIVSTFTVPDFLQLFTKSNLLPLIVFSILFGLATAF
FT                   SGEQGRPVAQFLRAGTAVILRMVKIIMYAAPLGLGCYFAATVGTLGPQIIHGYLNAFLL
FT                   YVVLTVIYFFGANTLYAFIAGGRPAVRIFWGNVFTPAITAIATASSAACIPVNLVASKK
FT                   MGVPADIAETVIPLGANTHKDGSVIGGIIKIVFLFTLFGRDMSDPMSIAAIISVAFLVG
FT                   AVMGAIPSGGMTGELMICAVFGFSPELVGTIMIISTIIDIPATLLNSTGNTVCAMLVTR
FT                   FVEGKAWLQRRWETAE"
     MHILRHYTFT LCLLLGIILG GLAGVLFGER ATLVQPIGEL FLNLMFVVIV PLVFLSIASS        60
     IADMRQMSRL GKIMGTVFSV FIATALFAAL IGFVATHLFN PFHNVDTRSL IAHLPPTPQG       120
     QGKGVGEVIV STFTVPDFLQ LFTKSNLLPL IVFSILFGLA TAFSGEQGRP VAQFLRAGTA       180
     VILRMVKIIM YAAPLGLGCY FAATVGTLGP QIIHGYLNAF LLYVVLTVIY FFGANTLYAF       240
     IAGGRPAVRI FWGNVFTPAI TAIATASSAA CIPVNLVASK KMGVPADIAE TVIPLGANTH       300
     KDGSVIGGII KIVFLFTLFG RDMSDPMSIA AIISVAFLVG AVMGAIPSGG MTGELMICAV       360
     FGFSPELVGT IMIISTIIDI PATLLNSTGN TVCAMLVTRF VEGKAWLQRR WETAE            415
//

If you have problems or comments...

PBIL Back to PBIL home page