(data stored in ACNUC7421 zone)

EMBL: CP001600.PE187

CP001600.PE187       Location/Qualifiers
FT   CDS             219093..219500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0213"
FT                   /product="protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67456"
FT                   /db_xref="GOA:C5B6Z4"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B6Z4"
FT                   /protein_id="ACR67456.1"
FT                   /translation="MPGTERANRVATVLQWILNIGLMALAAILVIFLAKETFTLAGVLF
FT                   DANQNASTYMLVEGIVIYFLYFEFIALIVKYFQSGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ESPNDTLIYSFAILVLVIALYLANTDRLKRE"
     MPGTERANRV ATVLQWILNI GLMALAAILV IFLAKETFTL AGVLFDANQN ASTYMLVEGI        60
     VIYFLYFEFI ALIVKYFQSG YHFPLRYFIY IGITAIIRLI IVDHESPNDT LIYSFAILVL       120
     VIALYLANTD RLKRE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page