(data stored in ACNUC7421 zone)

EMBL: CP001600.PE188

CP001600.PE188       Location/Qualifiers
FT   CDS             complement(219589..220479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0214"
FT                   /product="maltose transport system permease protein MalG,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67457"
FT                   /db_xref="GOA:C5B6Z5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z5"
FT                   /protein_id="ACR67457.1"
FT                   /translation="MAMVQPQSLRYRLWLTHLLMILFIALIMFPLLMVIAISLRTGNFA
FT                   TGSLIPDQISWEHWKLALGISVTAPDGRVTPPPFPVLLWLWNSLKVAVTTALGILTLST
FT                   TCAYAFARMRFRGKSSLLKGMLIFQMFPAVLSLVALYALFDRIGQYIPFLGLNTLGGVI
FT                   FAYMGGIALHVWTIKGYFETIDGSLEEAAALDGASPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNTYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITAVFLLA
FT                   QRWLVGGLTAGGVKG"
     MAMVQPQSLR YRLWLTHLLM ILFIALIMFP LLMVIAISLR TGNFATGSLI PDQISWEHWK        60
     LALGISVTAP DGRVTPPPFP VLLWLWNSLK VAVTTALGIL TLSTTCAYAF ARMRFRGKSS       120
     LLKGMLIFQM FPAVLSLVAL YALFDRIGQY IPFLGLNTLG GVIFAYMGGI ALHVWTIKGY       180
     FETIDGSLEE AAALDGASPW QAFRLVLLPL SVPILAVVFI LSFIAAITEV PVASLLLRDV       240
     NTYTLAVGMQ QYLNPQNYLW GDFAAAAVLS ALPITAVFLL AQRWLVGGLT AGGVKG           296
//

If you have problems or comments...

PBIL Back to PBIL home page